PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G233200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 625aa    MW: 69743.6 Da    PI: 8.9309
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G233200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox322e-104204571954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ ++++ LAk++gL+ +qV++WF N R +
  Aqcoe2G233200.1.p 420 FEHflHPYPTDTDKQMLAKQTGLSRSQVSNWFINARVR 457
                        664459******************************88 PP

2BELL101.56.2e-33288356472
               BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         ++kkk +L++ll+eV+krYk y +q qt+++sFe vaglg+a+pYts+Alk++S+hFrcLk+ai++q+
  Aqcoe2G233200.1.p 288 HHRKKKLRLITLLDEVYKRYKLYFQQTQTIVASFESVAGLGNAAPYTSFALKTMSKHFRCLKNAITDQL 356
                        68899*************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-42225354IPR006563POX domain
PfamPF075264.1E-35230353IPR006563POX domain
PROSITE profilePS5007112.422398461IPR001356Homeobox domain
CDDcd000861.81E-13401462No hitNo description
SMARTSM003892.0E-11401465IPR001356Homeobox domain
SuperFamilySSF466893.42E-17403467IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28404465IPR009057Homeodomain-like
PfamPF059202.3E-19418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MTEGFQSSFH YVPQQSRRDK LRVFLDNQQV HDDEQQQQQQ QQQLLDGLLP SLIPSHMLRK  60
QGRVKGGTSA RNSNNMHSIS YYKNTTTSSS SSSSSSPSAS HHYPHHHPYM LDPPLSSSLP  120
LNVYPSSLQD YNNFYIAQTL PEFDNSAVVG EALPINPSTM HMYKPQALSL TNDSSQRLSL  180
SLSSHHQQQL NLARSNLGCS SRGGGGGGAS TSNDIRSAVP LGPFTGYASI LKRSRFLVPA  240
QQMLEDFCDV GQGFYVERNS GDSLTMEENL NDTGIVNDLM ACSDGGEHHR KKKLRLITLL  300
DEVYKRYKLY FQQTQTIVAS FESVAGLGNA APYTSFALKT MSKHFRCLKN AITDQLRFSS  360
KSLGGERFNK NETLKFGTGE PWVHGQRTAY NSGILERRPV WRPQRGLPER AISVLRAWLF  420
EHFLHPYPTD TDKQMLAKQT GLSRSQVSNW FINARVRLWK PMVEEIHTLE TCQSDKGSGW  480
EDQNSSKHNE FMTLENPSHS SKQPQIKSAF KAQDQHSKRS RKEHVYSPEK VTTESMNFSY  540
NTSPSDHHHV GAGVGTSGGN SGVSLTLGLQ QNNGYGLSEA LPVNLPHRFG LEGNNEGYMI  600
ANFQASNQHY NEAVGGRLLH DFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16407465563Homeobox protein Meis2
3k2a_B2e-16407465563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010654234.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA5AHA10.0A5AHA1_VITVI; Putative uncharacterized protein
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.13e-91TALE family protein